PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_55E9080C2.2
Common NameWAG-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 273aa    MW: 30914.7 Da    PI: 9.1754
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_55E9080C2.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.61.2e-314696151
                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                           krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  Traes_3AS_55E9080C2.2 46 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 96
                           79***********************************************95 PP

2K-box921.1e-301142114100
                  K-box   4 ssgks.leeakaeslqqelakLkkeienLq.reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                            s++   ++e +a+++qqe++kL+++i++Lq ++ R l+ +++++++l++L+qLe +Lek++ kiR++Knel+++++e++qk+e elq+
  Traes_3AS_55E9080C2.2 114 SNS-GtVAEVNAQYYQQESSKLRQQISSLQnSNSRSLVRDSVSTMTLRDLKQLEGRLEKGIAKIRARKNELMYAEVEYMQKREMELQN 200
                            333.25999*********************9899****************************************************** PP

                  K-box  90 enkaLrkklee 100
                            +n +Lr+k+ e
  Traes_3AS_55E9080C2.2 201 DNIYLRSKVSE 211
                            ********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.883898IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-423897IPR002100Transcription factor, MADS-box
CDDcd002653.30E-4539112No hitNo description
SuperFamilySSF554551.23E-3239110IPR002100Transcription factor, MADS-box
PROSITE patternPS0035004094IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-324060IPR002100Transcription factor, MADS-box
PfamPF003191.1E-264794IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-326075IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-327596IPR002100Transcription factor, MADS-box
PfamPF014869.4E-22123209IPR002487Transcription factor, K-box
PROSITE profilePS5129713.742124215IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MMSMMADLSC GASGVTVNDH QLAAPAPEDS AAAGSEKMGR GRIEIKRIEN TTNRQVTFCK  60
RRNGLLKKAY ELSVLCDAEV ALIVFSSRGR LYEYSNNSVK ATIERYKKAN SDTSNSGTVA  120
EVNAQYYQQE SSKLRQQISS LQNSNSRSLV RDSVSTMTLR DLKQLEGRLE KGIAKIRARK  180
NELMYAEVEY MQKREMELQN DNIYLRSKVS ENERGQQPVN MMASGSASSE YDHMVSPYDS  240
RNFLQANIMQ QQQQHYSQQL QPTALQLGQQ YFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-2038106169Myocyte-specific enhancer factor 2B
1tqe_Q2e-2038106169Myocyte-specific enhancer factor 2B
1tqe_R2e-2038106169Myocyte-specific enhancer factor 2B
1tqe_S2e-2038106169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4656880.0AB465688.1 Triticum aestivum WAG-2 mRNA for MADS-box transcription factor, complete cds, cultivar: Norin 26.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289811.11e-154MADS-box transcription factor 3
RefseqXP_010230591.11e-154PREDICTED: MADS-box transcription factor 3 isoform X1
RefseqXP_010230592.11e-154PREDICTED: MADS-box transcription factor 3 isoform X1
SwissprotQ407041e-148MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0S1W5Y30.0A0A0S1W5Y3_TRIDC; WAG-2h MADS box transcription factor
TrEMBLC0STS70.0C0STS7_WHEAT; MADS-box transcription factor
STRINGMLOC_5375.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-102MIKC_MADS family protein
Publications ? help Back to Top
  1. Mizumoto K,Hatano H,Hirabayashi C,Murai K,Takumi S
    Altered expression of wheat AINTEGUMENTA homolog, WANT-1, in pistil and pistil-like transformed stamen of an alloplasmic line with Aegilops crassa cytoplasm.
    Dev. Genes Evol., 2009. 219(4): p. 175-87
    [PMID:19255779]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  3. Wang QH, et al.
    Molecular cloning, characterization and expression analysis of WAG-1 in the pistillody line of common wheat.
    Genet. Mol. Res., 2015. 14(4): p. 12455-65
    [PMID:26505395]